LL-37 (HUMAN CATHELICIDIN ANTIMICROBIAL PEPTIDE)
Compound Overview
LL-37 is a naturally occurring 37-amino acid cationic antimicrobial peptide derived from the C-terminal region of the human cathelicidin precursor protein hCAP18 (CAMP). It is the only known human cathelicidin peptide and serves as an important component of the innate immune system. Due to its amphipathic α-helical structure and broad biological activity, LL-37 has become a valuable investigational peptide in immunology, microbiology, and molecular biology research.
Researchers have extensively investigated LL-37 for its interactions with microbial membranes, host immune signaling pathways, chemotaxis, cytokine regulation, epithelial biology, and wound repair mechanisms. In addition to its direct antimicrobial properties, LL-37 has been studied for its role in modulating inflammatory responses, biofilm formation, angiogenesis, and cellular communication. These diverse biological functions have established LL-37 as an important research tool for studying innate immunity, host-pathogen interactions, and peptide-mediated cellular signaling.
As an investigational peptide, LL-37 supports laboratory research involving immunology, infectious disease biology, molecular pharmacology, peptide engineering, and structure-activity relationship studies.
Research Applications
Research applications are presented for educational and informational purposes only and do not imply approved therapeutic uses.
Product Specifications
| Purity | 99% |
| Appearance | White to Off-White Lyophilized Powder |
| Sequence | [LL-37, 37 aa] |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4,493.27 g/mol |
| CAS Number | 154947-66-7 |
| Storage | Store refrigerated at 2–8°C (36–46°F). For extended laboratory storage, maintain at −20°C or below. Protect from moisture and light. |
| Research Grade | Laboratory Research Use Only |
Available Sizes
Pricing: Inquire — contact our team for current pricing and availability.
Product Documentation
Every batch of LL-37 (HUMAN CATHELICIDIN ANTIMICROBIAL PEPTIDE) is independently tested and assigned its own lot number. When you request documentation, include the product name and lot number printed on your vial so we can send the COA, HPLC, and MS data specific to the batch in your hand — not a generic reference sample. Request documentation →
Laboratory Handling
Store refrigerated immediately upon receipt to preserve peptide stability. For extended laboratory storage, freezing at −20°C or below is recommended. Protect the lyophilized peptide from moisture, excessive heat, and direct light. Avoid repeated freeze-thaw cycles following reconstitution, as these may reduce peptide stability and biological integrity. Allow the vial to equilibrate to room temperature before opening to minimize condensation, and always use sterile laboratory equipment together with appropriate aseptic laboratory techniques. This product is intended for use only by qualified research personnel operating in controlled laboratory environments.
Selected Scientific Literature
- Dürr UHN, Sudheendra US, Ramamoorthy A. LL-37, the Only Human Member of the Cathelicidin Family of Antimicrobial Peptides. Biochimica et Biophysica Acta (BBA) – Biomembranes.
- Nijnik A, Hancock REW. The Roles of Cathelicidin LL-37 in Immune Defences and Novel Clinical Applications. Current Opinion in Hematology.
- Overhage J, Campisano A, Bains M, et al. Human Host Defense Peptide LL-37 Prevents Bacterial Biofilm Formation. Infection and Immunity.
- Kahlenberg JM, Kaplan MJ. Little Peptide, Big Effects: The Role of LL-37 in Inflammation and Autoimmune Disease. Journal of Immunology.
Compare with related compounds
Other compounds researchers commonly browse alongside LL-37 (HUMAN CATHELICIDIN ANTIMICROBIAL PEPTIDE) in Immune & Antioxidant.
| Compound | Purity | Molecular Weight | CAS Number |
|---|---|---|---|
| LL-37 (HUMAN CATHELICIDIN ANTIMICROBIAL PEPTIDE) | 99% | 4,493.27 g/mol | 154947-66-7 |
| THYMOSIN ALPHA-1 (Tα1) | 99% | 3,108.3 g/mol | 62304-98-7 |
| GLUTATHIONE (REDUCED L-GLUTATHIONE) | 99% | 307.32 g/mol | 70-18-8 |
| KPV (LYS-PRO-VAL) | 99% | 358.43 g/mol | 67727-97-3 |
Need a Certificate of Analysis?
Request COAs, HPLC, or MS documentation for LL-37 (HUMAN CATHELICIDIN ANTIMICROBIAL PEPTIDE).